PDB entry 1byv

View 1byv on RCSB PDB site
Description: glycosylated eel calcitonin
Class: hormone/growth factor
Keywords: horomone, calcium-regulator, osteoporosis, hormone-growth factor complex
Deposited on 1998-10-16, released 1998-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (calcitonin)
  Species: Anguilla japonica [TaxId:7937]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01262 (0-31)
  Domains in SCOPe 2.08: d1byva_
• Heterogens: NAG

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1byvA (A:)
  csnlstcvlgklsqelhklqtyprtdvgagtp