PDB entry 1byu

View 1byu on RCSB PDB site
Description: canine GDP-ran
Class: transport protein
Keywords: gtpase, nuclear transport, transport protein
Deposited on 1998-10-18, released 1998-12-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.176
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (GTP-binding protein ran)
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1byua_
  • Chain 'B':
    Compound: protein (GTP-binding protein ran)
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1byub_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1byuA (A:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1byuA (A:)
    epqvqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikfnvwd
    tagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd
    ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalapp
    evvmdpalaaqyehdlevaqtt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1byuB (B:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1byuB (B:)
    aaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikf
    nvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcg
    nkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampa
    lappevvmdpalaaqyehdlevaqttalpdedddl