PDB entry 1byt

View 1byt on RCSB PDB site
Description: lipoxygenase-3 (soybean) complex with 4-nitrocatechol
Class: oxidoreductase
Keywords: oxidoreductase, metalloprotein, fe(II) complex, catechol
Deposited on 1998-10-20, released 1999-02-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2003-04-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.259
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoxygenase-3
    Species: Glycine max
    Database cross-references and differences (RAF-indexed):
    • GB AAB41272 (Start-856)
    Domains in SCOPe 2.06: d1byta1, d1byta2
  • Heterogens: FE2, 4NC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bytA (A:)
    mlggllhrghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvsl
    qlisatkadangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknf
    mqtefflvsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyr
    eeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgr
    kptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftpre
    fdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmt
    deefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiq
    nkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsg
    afsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvv
    hpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqal
    padlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlre
    dpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypyg
    glilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasde
    vylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllp
    sskegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bytA (A:)
    ghkikgtvvlmrknvldvnsvtsvtldtltaflgrsvslqlisatkadangkgklgkatf
    legiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflvsltledipnhgsi
    hfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhnlrgdgtgerkeweri
    ydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkdpnsesrsndvylprd
    eafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfdevhglysggiklptdi
    iskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefaremlagvnpnlirclk
    dfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlflldhhdpimpylrrin
    atstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvflpadegvessiwlla
    kayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykllhphyrdtmningla
    rlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlikrgmaiedpscphgir
    lviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqacwkelvevghgdkkn
    epwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnrptlsrrfmpekgsae
    yeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylgerdnpnwtsdtraleaf
    krfgnklaqienklsernndeklrnrcgpvqmpytlllpsskegltfrgipnsisi