PDB entry 1byt

View 1byt on RCSB PDB site
Description: lipoxygenase-3 (soybean) complex with 4-nitrocatechol
Deposited on 1998-10-20, released 1999-02-02
The last revision prior to the SCOP 1.57 freeze date was dated 1999-05-11, with a file datestamp of 1999-05-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.259
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1byt_ (-)
    ghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatka
    dangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflv
    sltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhnlr
    gdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkdpn
    sesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfdevh
    glysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefarem
    lagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlflld
    hhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvflp
    adegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykllh
    phyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlikrg
    maiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqacw
    kelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnrpt
    lsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylgerdn
    pnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllpsskegltf
    rgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1byt_ (-)
    ghkikgtvvlmrknvldvnsvtsvtldtltaflgrsvslqlisatkadangkgklgkatf
    legiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflvsltledipnhgsi
    hfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhnlrgdgtgerkeweri
    ydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkdpnsesrsndvylprd
    eafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfdevhglysggiklptdi
    iskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefaremlagvnpnlirclk
    dfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlflldhhdpimpylrrin
    atstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvflpadegvessiwlla
    kayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykllhphyrdtmningla
    rlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlikrgmaiedpscphgir
    lviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqacwkelvevghgdkkn
    epwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnrptlsrrfmpekgsae
    yeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylgerdnpnwtsdtraleaf
    krfgnklaqienklsernndeklrnrcgpvqmpytlllpsskegltfrgipnsisi