PDB entry 1byr

View 1byr on RCSB PDB site
Description: crystal structure of a phospholipase d family member, nuc from salmonella typhimurium
Class: endonuclease
Keywords: endonuclease, phosphodiesterase,
Deposited on 1998-10-19, released 1999-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (endonuclease)
    Species: Salmonella typhimurium [TaxId:602]
    Gene: nuc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1byra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1byrA (A:)
    vepsvqvgyspegsarvlvlsaidsaktsirmmaysftapdimkalvaakkrgvdvkivi
    dergntgrasiaamnyiansgiplrtdsnfpiqhdkviivdnvtvetgsfnftkaaetkn
    senavviwnmpklaesflehwqdrwnqgrdyrssy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1byrA (A:)
    epsvqvgyspegsarvlvlsaidsaktsirmmaysftapdimkalvaakkrgvdvkivid
    ergntgrasiaamnyiansgiplrtdsnfpiqhdkviivdnvtvetgsfnftkaaetkns
    enavviwnmpklaesflehwqdrwnqgrdyrs