PDB entry 1byp

View 1byp on RCSB PDB site
Description: e43k,d44k double mutant plastocyanin from silene
Class: electron transport
Keywords: electron transfer, photosynthesis, acidic patch, double mutant
Deposited on 1998-10-19, released 1999-10-19
The last revision prior to the SCOP 1.73 freeze date was dated 1999-10-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.18
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (plastocyanin)
  Species: Silene pratensis
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07030 (0-98)
    • conflict (38-39)
    • engineered (42-43)
  Domains in SCOP 1.73: d1bypa_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bypA (A:)
  aevllgssdgglafvpsdlsiasgekitfknnagfphndlfdkkevpagvdvtkismpee
  dllnapgeeysvtltekgtykfycaphagagmvgkvtvn