PDB entry 1byp

View 1byp on RCSB PDB site
Description: e43k,d44k double mutant plastocyanin from silene
Class: electron transport
Keywords: electron transfer, photosynthesis, acidic patch, double mutant, electron transport
Deposited on 1998-10-19, released 1999-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.18
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (plastocyanin)
    Species: Silene latifolia subsp. alba [TaxId:52853]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07030 (0-98)
      • conflict (38-39)
      • engineered (42-43)
    Domains in SCOPe 2.07: d1bypa_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bypA (A:)
    aevllgssdgglafvpsdlsiasgekitfknnagfphndlfdkkevpagvdvtkismpee
    dllnapgeeysvtltekgtykfycaphagagmvgkvtvn