PDB entry 1byn

View 1byn on RCSB PDB site
Description: solution structure of the calcium-bound first c2-domain of synaptotagmin I
Class: endocytosis/exocytosis
Keywords: synaptotagmin, c2-domain, exocytosis, neurotransmitter release, endocytosis/exocytosis complex
Deposited on 1998-10-18, released 1998-10-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (synaptotagmin I)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21707 (0-127)
      • conflict (48)
    Domains in SCOPe 2.03: d1byna_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bynA (A:)
    eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
    ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
    rdlqsaek