PDB entry 1bym

View 1bym on RCSB PDB site
Description: solution structures of the c-terminal domain of diphtheria toxin repressor
Class: gene regulation
Keywords: repressor, dtxr, c-terminal domain, prokaryotic sh3 domain, transcription regulation, peptide-binding
Deposited on 1998-10-17, released 1998-10-21
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (diphtheria toxin repressor)
  Species: Corynebacterium diphtheriae
  Gene: DTXR
  Database cross-references and differences (RAF-indexed):
  • Uniprot P33120 (0-96)
  Domains in SCOP 1.75: d1byma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bymA (A:)
  npipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqftqlldadirv
  gseveivdrdghitlshngkdvellddlahtirieel