PDB entry 1bym

View 1bym on RCSB PDB site
Description: solution structures of the c-terminal domain of diphtheria toxin repressor
Class: gene regulation
Keywords: repressor, dtxr, c-terminal domain, prokaryotic sh3 domain, transcription regulation, peptide-binding, gene regulation
Deposited on 1998-10-17, released 1998-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (diphtheria toxin repressor)
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DTXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1byma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bymA (A:)
    npipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqftqlldadirv
    gseveivdrdghitlshngkdvellddlahtirieel