PDB entry 1byl

View 1byl on RCSB PDB site
Description: bleomycin resistance protein from streptoalloteichus hindustanus
Class: antibiotic
Keywords: antibiotic resistance, bleomycin, drug sequestering, chain swapping, antibiotic
Deposited on 1998-10-17, released 1999-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (bleomycin resistance protein)
    Species: Streptoalloteichus hindustanus [TaxId:2017]
    Gene: SH BLE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17493 (1-End)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1byla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bylA (A:)
    fmakltsavpvltardvagavefwtdrlgfsrdfveddfagvvrddvtlfisavqdqvvp
    dntlawvwvrgldelyaewsevvstnfrdasgpamteigeqpwgrefalrdpagncvhfv
    aeeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bylA (A:)
    fmakltsavpvltardvagavefwtdrlgfsrdfveddfagvvrddvtlfisavqdqvvp
    dntlawvwvrgldelyaewsevvstnfrdasgpamteigeqpwgrefalrdpagncvhfv
    ae