PDB entry 1byi

View 1byi on RCSB PDB site
Description: structure of apo-dethiobiotin synthase at 0.97 angstroms resolution
Class: ligase
Keywords: biotin synthesis, cyclo-ligase, ligase
Deposited on 1998-10-15, released 1999-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.116
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dethiobiotin synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1byia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1byiA (A:)
    skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
    nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
    ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
    gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall