PDB entry 1byh

View 1byh on RCSB PDB site
Description: molecular and active-site structure of a bacillus (1-3,1-4)-beta-glucanase
Class: hydrolase
Keywords: hydrolase
Deposited on 1992-12-31, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-07-20.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.168
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hybrid
    Species: synthetic construct, synthetic
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA81097 (0-213)
    Domains in SCOP 1.73: d1byha_
  • Heterogens: CA, NBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1byhA (A:)
qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
mnlwngtgvddwlgsynganplyaeydwvkytsn