PDB entry 1byh

View 1byh on RCSB PDB site
Description: molecular and active-site structure of a bacillus (1-3,1-4)-beta-glucanase
Class: hydrolase
Keywords: hydrolase
Deposited on 1992-12-31, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hybrid
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA81097 (0-213)
    Domains in SCOPe 2.08: d1byha_
  • Heterogens: CA, NBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1byhA (A:)
qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
mnlwngtgvddwlgsynganplyaeydwvkytsn