PDB entry 1byf

View 1byf on RCSB PDB site
Description: structure of tc14; a c-type lectin from the tunicate polyandrocarpa misakiensis
Class: sugar binding protein
Keywords: c-type lectin, galactose-specific, sugar binding protein
Deposited on 1998-10-14, released 1999-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (polyandrocarpa lectin)
    Species: Polyandrocarpa misakiensis, synthetic [TaxId:7723]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1byfa_
  • Chain 'B':
    Compound: protein (polyandrocarpa lectin)
    Species: Polyandrocarpa misakiensis, synthetic [TaxId:7723]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1byfb_
  • Heterogens: CA, ZN, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1byfA (A:)
    mdyeilfsdetmnyadagtycqsrgmalvssamrdstmvkailaftevkghdywvgadnl
    qdgaynflwndgvslptdsdlwspnepsnpqswqlcvqiwskynllddvgcggarrvice
    keldd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1byfA (A:)
    dyeilfsdetmnyadagtycqsrgmalvssamrdstmvkailaftevkghdywvgadnlq
    dgaynflwndgvslptdsdlwspnepsnpqswqlcvqiwskynllddvgcggarrvicek
    eld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1byfB (B:)
    mdyeilfsdetmnyadagtycqsrgmalvssamrdstmvkailaftevkghdywvgadnl
    qdgaynflwndgvslptdsdlwspnepsnpqswqlcvqiwskynllddvgcggarrvice
    keldd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1byfB (B:)
    dyeilfsdetmnyadagtycqsrgmalvssamrdstmvkailaftevkghdywvgadnlq
    dgaynflwndgvslptdsdlwspnepsnpqswqlcvqiwskynllddvgcggarrvicek
    eld