PDB entry 1bye

View 1bye on RCSB PDB site
Description: glutathione s-transferase I from mais in complex with atrazine glutathione conjugate
Class: transferase
Keywords: glutathione s-transferase, herbicide
Deposited on 1998-10-14, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.221
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glutathione s-transferase)
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1byea1, d1byea2
  • Chain 'B':
    Compound: protein (glutathione s-transferase)
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1byeb1, d1byeb2
  • Chain 'C':
    Compound: protein (glutathione s-transferase)
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1byec1, d1byec2
  • Chain 'D':
    Compound: protein (glutathione s-transferase)
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1byed1, d1byed2
  • Heterogens: ATA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1byeA (A:)
    apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
    dlylfesraickyaarknkpellregnleeaamvdvwieveanqytaalnpilfqvlisp
    mlggttdqkvvdenleklkkvlevyearltkckylagdflsladlnhvsvtlclfatpya
    svldayphvkawwsglmerpsvqkvaalmkpsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1byeB (B:)
    apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
    dlylfesraickyaarknkpellregnleeaamvdvwieveanqytaalnpilfqvlisp
    mlggttdqkvvdenleklkkvlevyearltkckylagdflsladlnhvsvtlclfatpya
    svldayphvkawwsglmerpsvqkvaalmkpsa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1byeC (C:)
    apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
    dlylfesraickyaarknkpellregnleeaamvdvwieveanqytaalnpilfqvlisp
    mlggttdqkvvdenleklkkvlevyearltkckylagdflsladlnhvsvtlclfatpya
    svldayphvkawwsglmerpsvqkvaalmkpsa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1byeD (D:)
    apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
    dlylfesraickyaarknkpellregnleeaamvdvwieveanqytaalnpilfqvlisp
    mlggttdqkvvdenleklkkvlevyearltkckylagdflsladlnhvsvtlclfatpya
    svldayphvkawwsglmerpsvqkvaalmkpsa