PDB entry 1byc

View 1byc on RCSB PDB site
Description: crystal structures of soybean beta-amylase reacted with beta-maltose and maltal: active site components and their apparent role in catalysis
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1994-01-25, released 1994-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.149
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-amylase
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1byca_
  • Heterogens: BGC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bycA (A:)
    atsdsnmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiie
    lkgpkqydwrayrslfqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhd
    ifytnrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievg
    lgpagelrypsypqsqgwefprigefqcydkylkadfkaavaraghpewelpddagkynd
    vpestgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgih
    wwykvenhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpq
    elvqqvlsggwredirvagenalprydataynqiilnakpqgvnnngppklsmfgvtylr
    lsddllqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkpt
    lpfpwlpetdmkvdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bycA (A:)
    snmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgp
    kqydwrayrslfqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifyt
    nrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpa
    gelrypsypqsqgwefprigefqcydkylkadfkaavaraghpewelpddagkyndvpes
    tgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwyk
    venhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvq
    qvlsggwredirvagenalprydataynqiilnakpqgvnnngppklsmfgvtylrlsdd
    llqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfp
    wlpetdmkvdg