PDB entry 1by9

View 1by9 on RCSB PDB site
Description: crystal structure of the e2 DNA-binding domain from human papillomavirus type-16: implications for its DNA binding-site selection mechanism
Class: transcription regulation
Keywords: papillomavirus, transcription regulation, beta-barrel
Deposited on 1998-10-27, released 1999-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.195
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein E2
    Species: Human papillomavirus type 16 [TaxId:333760]
    Gene: E2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1by9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1by9A (A:)
    ttpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
    qflsqvkipktitvstgfmsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1by9A (A:)
    ttpivhlkgdantlkclryrfkkhctlytavsstwhwtaivtltydsewqrdqflsqvki
    pktitvstgfms