PDB entry 1by7

View 1by7 on RCSB PDB site
Description: human plasminogen activator inhibitor-2. loop (66-98) deletion mutant
Class: protein binding
Keywords: serpin, protein binding
Deposited on 1998-10-27, released 1999-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (plasminogen activator inhibitor-2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1by7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1by7A (A:)
    medlcvantlfalnlfkhlakasptqnlflspwsisstmamvymgsrgstedqmakvlqf
    nevgaaadkihssfrslssainastgnyllesvnklfgeksasfreeyirlcqkyyssep
    qavdflecaeearkkinswvktqtkgkipnllpegsvdgdtrmvlvnavyfkgkwktpfe
    kklnglypfrvnsaqrtpvqmmylreklnigyiedlkaqilelpyagdvsmflllpdeia
    dvstglelleseitydklnkwtskdkmaedevevyipqfkleehyelrsilrsmgmedaf
    nkgranfsgmserndlflsevfhqamvdvneegteaaagtggvmtgrtghggpqfvadhp
    flflimhkitncilffgrfssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1by7A (A:)
    edlcvantlfalnlfkhlakasptqnlflspwsisstmamvymgsrgstedqmakvlqfn
    evgaadkihssfrslssainllesvnklfgeksasfreeyirlcqkyyssepqavdflec
    aeearkkinswvktqtkgkipnllpegsvdgdtrmvlvnavyfkgkwktpfekklypfrv
    nsaqrtpvqmmylreklnigyiedlkaqilelpyagdvsmflllpdeiadvstglelles
    eitydklnkwtskdkmaedevevyipqfkleehyelrsilrsmgmedafnkgranfsgms
    erndlflsevfhqamvdvneegtgpqfvadhpflflimhkitncilffgrfssp