PDB entry 1by6

View 1by6 on RCSB PDB site
Description: Peptide of human apolipoprotein C-II
Class: signaling protein
Keywords: apolipoprotein, amphipathic helix, lipid association, lpl activation, signaling protein
Deposited on 1999-12-03, released 2000-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein c-II
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1by6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1by6A (A:)
    avdeklrdlyskstaamstytgiftdqvlsvlkgee