PDB entry 1by6

View 1by6 on RCSB PDB site
Description: Peptide of human apolipoprotein C-II
Class: signaling protein
Keywords: apolipoprotein, amphipathic helix, lipid association, lpl activation, signaling protein
Deposited on 1999-12-03, released 2000-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: apolipoprotein c-II
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02655 (0-35)
  Domains in SCOPe 2.08: d1by6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1by6A (A:)
  avdeklrdlyskstaamstytgiftdqvlsvlkgee