PDB entry 1by5

View 1by5 on RCSB PDB site
Description: fhua from e. coli, with its ligand ferrichrome
Deposited on 1998-10-23, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.184
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1by5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1by5A (A:)
    qesawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvs
    vgtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvs
    vlygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgl
    arsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplp
    ngkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygv
    csdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltg
    vdfmrmrndinawfgyddsvpllnlynpvntdfdfnakdpansgpyrilnkqkqtgvyvq
    dqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfdngvtpyfsys
    esfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktnnlmadpegsf
    fsveggeirargveieakrplsasvnvvgsytytdaeyttdttykgntpaqvpkhmaslw
    adytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydlarvgmagsnva
    lhvnnlfdreyvascfntygcfwgaerqvvatatfrf