PDB entry 1by3

View 1by3 on RCSB PDB site
Description: fhua from e. coli
Deposited on 1998-10-22, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-01, with a file datestamp of 2000-05-01.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: 0.186
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1by3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1by3A (A:)
    sawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsvg
    trgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsvl
    ygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltglar
    sanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpng
    krlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvcs
    dpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgvd
    fmrmrndinawfgyddsvpllnlynpvntdfdfnakdpansgpyrilnkqkqtgvyvqdq
    aqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfdngvtpyfsyses
    fepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktnnlmadpegsffs
    veggeirargveieakrplsasvnvvgsytytdaeyttdttykgntpaqvpkhmaslwad
    ytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydlarvgmagsnvalh
    vnnlfdreyvascfntygcfwgaerqvvatatfrf