PDB entry 1by3

View 1by3 on RCSB PDB site
Description: fhua from e. coli
Class: membrane protein
Keywords: fhua, membrane protein, ligand-gated, iron transport
Deposited on 1998-10-22, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: 0.186
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ferrichrome-iron receptor precursor (fhua))
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06971 (Start-713)
      • conflict (575-576)
    Domains in SCOPe 2.07: d1by3a_
  • Heterogens: OES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1by3A (A:)
    avepkedtitvtaapapqesawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemal
    hqpksvkealsytpgvsvgtrgasntydhliirgfaaegqsqnnylnglklqgnfyndav
    idpymleraeimrgpvsvlygksspggllnmvskrptteplkevqfkagtdslfqtgfdf
    sdsldddgvysyrltglarsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepe
    tgyygwlpkegtveplpngkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnl
    rfaenktsqnsvygygvcsdpanayskqcaalapadkghylarkyvvddeklqnfsvdtq
    lqskfatgdidhtlltgvdfmrmrndinawfgyddsvpllnlynpvntdfdfnakdpans
    gpyrilnkqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrg
    gvnylfdngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgav
    ynltktnnlmadpegsffsveggeirargveieakrplsasvnvvgsytytdaeyttdtt
    ykgntpaqvpkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvda
    lvrydlarvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1by3A (A:)
    sawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsvg
    trgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsvl
    ygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltglar
    sanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpng
    krlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvcs
    dpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgvd
    fmrmrndinawfgyddsvpllnlynpvntdfdfnakdpansgpyrilnkqkqtgvyvqdq
    aqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfdngvtpyfsyses
    fepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktnnlmadpegsffs
    veggeirargveieakrplsasvnvvgsytytdaeyttdttykgntpaqvpkhmaslwad
    ytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydlarvgmagsnvalh
    vnnlfdreyvascfntygcfwgaerqvvatatfrf