PDB entry 1by2

View 1by2 on RCSB PDB site
Description: structure of m2bp scavenger receptor cysteine-rich domain
Class: extracellular module
Keywords: extracellular module, scavenger receptor, tumour-associated antigen, extracellular matrix, glycosylated protein
Deposited on 1998-10-23, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mac-2 binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1by2a1, d1by2a2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1by2A (A:)
    aplavndgdmrladggatnqgrveifyrgqwgtvcdnlwdltdasvvcralgfenatqal
    graafgqgsgpimldevqctgteasladckslgwlksncrherdagvvctnetrsthtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1by2A (A:)
    avndgdmrladggatnqgrveifyrgqwgtvcdnlwdltdasvvcralgfenatqalgra
    afgqgsgpimldevqctgteasladckslgwlksncrherdagvvctnettl