PDB entry 1bxz

View 1bxz on RCSB PDB site
Description: crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii
Deposited on 1998-10-09, released 2000-02-18
The last revision prior to the SCOP 1.61 freeze date was dated 2000-02-18, with a file datestamp of 2000-02-18.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.2142
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxzA (A:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxzB (B:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxzC (C:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxzD (D:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila