PDB entry 1bxz

View 1bxz on RCSB PDB site
Description: crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii
Class: oxidoreductase
Keywords: thermophilic alcohol dehydrogenase, crystal structure, oxidoreductase
Deposited on 1998-10-09, released 2000-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.214
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Thermoanaerobacter brockii [TaxId:29323]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bxza1, d1bxza2
  • Chain 'B':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Thermoanaerobacter brockii [TaxId:29323]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bxzb1, d1bxzb2
  • Chain 'C':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Thermoanaerobacter brockii [TaxId:29323]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bxzc1, d1bxzc2
  • Chain 'D':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Thermoanaerobacter brockii [TaxId:29323]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bxzd1, d1bxzd2
  • Heterogens: ZN, CL, MG, SBT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxzA (A:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxzB (B:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxzC (C:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxzD (D:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila