PDB entry 1bxy

View 1bxy on RCSB PDB site
Description: crystal structure of ribosomal protein l30 from thermus thermophilus at 1.9 a resolution: conformational flexibility of the molecule.
Class: ribosome
Keywords: ribosomal protein, x-ray crystallography, conformational changes, ribosome
Deposited on 1998-10-09, released 1998-10-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (ribosomal protein l30)
  Species: Thermus thermophilus [TaxId:274]
  Gene: RPL30
  Database cross-references and differences (RAF-indexed):
  • Uniprot P74909 (0-59)
  Domains in SCOPe 2.02: d1bxya_
• Chain 'B':
  Compound: protein (ribosomal protein l30)
  Species: Thermus thermophilus [TaxId:274]
  Gene: RPL30
  Database cross-references and differences (RAF-indexed):
  • Uniprot P74909 (0-59)
  Domains in SCOPe 2.02: d1bxyb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bxyA (A:)
  mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bxyB (B:)
  mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve