PDB entry 1bxy

View 1bxy on RCSB PDB site
Description: crystal structure of ribosomal protein l30 from thermus thermophilus at 1.9 a resolution: conformational flexibility of the molecule.
Class: ribosome
Keywords: ribosomal protein, conformational changes, ribosome
Deposited on 1998-10-09, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribosomal protein l30)
    Species: Thermus thermophilus [TaxId:274]
    Gene: RPL30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bxya_
  • Chain 'B':
    Compound: protein (ribosomal protein l30)
    Species: Thermus thermophilus [TaxId:274]
    Gene: RPL30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bxyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxyA (A:)
    mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxyB (B:)
    mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve