PDB entry 1bxx

View 1bxx on RCSB PDB site
Description: mu2 adaptin subunit (ap50) of ap2 adaptor (second domain), complexed with tgn38 internalization peptide dyqrln
Class: endocytosis/exocytosis
Keywords: endocytosis, adaptor, peptide complex, endocytosis/exocytosis complex
Deposited on 1998-10-08, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.282
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ap50)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bxxa_
  • Chain 'P':
    Compound: protein (tgn38 peptide)
    Database cross-references and differences (RAF-indexed):
    • PDB 1BXX (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bxxA (A:)
    mhhhhhhqigwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmp
    eckfgmndkiviekqgkgtadetsksgkqsiaiddctfhqcvrlskfdsersisfippdg
    efelmryrttkdiilpfrviplvrevgrtklevkvviksnfkpsllaqkievriptplnt
    sgvqvicmkgkakykasenaivwkikrmagmkesqisaeiellptndkkkwarppismnf
    evpfapsglkvrylkvfepklnysdhdvikwvryigrsgiyetrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxxA (A:)
    igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
    kikqsiaiddctfhqcvrlsersisfippdgefelmryrttkdiilpfrviplvrevgrt
    klevkvviksnfkpsllaqkievriptplntsgvqvicmkgkakykasenaivwkikrma
    gmkesqisaeiellptndkkkwarppismnfevpfapsglkvrylkvfepklnysdhdvi
    kwvryigrsgiyetrc
    

  • Chain 'P':
    No sequence available.