PDB entry 1bxw

View 1bxw on RCSB PDB site
Description: outer membrane protein a (ompa) transmembrane domain
Class: membrane protein
Keywords: outer membrane, transmembrane protein, membrane protein
Deposited on 1998-10-03, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (outer membrane protein a)
    Species: Escherichia coli [TaxId:469008]
    Gene: OMPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A910 (0-171)
      • see remark 999 (0)
      • engineered mutation (23)
      • engineered mutation (34)
      • engineered mutation (107)
    Domains in SCOPe 2.08: d1bxwa_
  • Heterogens: C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bxwA (A:)
mapkdntwytgaklgwsqyhdtglinnngpthenklgagafggyqvnpyvgfemgydwlg
rmpykgsvengaykaqgvqltaklgypitddldiytrlggmvwradtysnvygknhdtgv
spvfaggveyaitpeiatrleyqwtnnigdahtigtrpdngmlslgvsyrfg