PDB entry 1bxu

View 1bxu on RCSB PDB site
Description: oxidized plastocyanin from synechococcus sp.
Class: copper protein
Keywords: copper protein, electron transfer
Deposited on 1998-10-09, released 1999-06-15
The last revision prior to the SCOP 1.75 freeze date was dated 1999-06-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.151
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plastocyanin
    Species: Synechococcus sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1bxua_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bxuA (A:)
qtvaikmgadngmlafepstieiqagdtvqwvnnklaphnvvvegqpelshkdlafspge
tfeatfsepgtytyycephrgagmvgkivvq