PDB entry 1bxu

View 1bxu on RCSB PDB site
Description: oxidized plastocyanin from synechococcus sp.
Deposited on 1998-10-09, released 1999-06-15
The last revision prior to the SCOP 1.61 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.151
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1bxua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bxuA (A:)
  qtvaikmgadngmlafepstieiqagdtvqwvnnklaphnvvvegqpelshkdlafspge
  tfeatfsepgtytyycephrgagmvgkivvq