PDB entry 1bxu

View 1bxu on RCSB PDB site
Description: oxidized plastocyanin from synechococcus sp.
Deposited on 1998-10-09, released 1999-06-15
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.151
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bxua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxuA (A:)
    qtvaikmgadngmlafepstieiqagdtvqwvnnklaphnvvvegqpelshkdlafspge
    tfeatfsepgtytyycephrgagmvgkivvq