PDB entry 1bxu

View 1bxu on RCSB PDB site
Description: oxidized plastocyanin from synechococcus sp.
Class: copper protein
Keywords: copper protein, electron transfer
Deposited on 1998-10-09, released 1999-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.151
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plastocyanin
  Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55020 (0-90)
  Domains in SCOPe 2.08: d1bxua_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bxuA (A:)
  qtvaikmgadngmlafepstieiqagdtvqwvnnklaphnvvvegqpelshkdlafspge
  tfeatfsepgtytyycephrgagmvgkivvq