PDB entry 1bxt

View 1bxt on RCSB PDB site
Description: streptococcal superantigen (ssa) from streptococcus pyogenes
Class: immune system
Keywords: bacterial superantigen, MHC class II interaction, t cell activation, toxic shock-like syndrome, immune system
Deposited on 1998-10-08, released 1998-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.237
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (streptococcal superantigen)
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bxta1, d1bxta2
  • Chain 'B':
    Compound: protein (streptococcal superantigen)
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bxtb1, d1bxtb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bxtA (A:)
    ssqpdptpeqlnkssqftgvmgnlrclydnhfvegtnvrstgqllqhdlifpikdlklkn
    ydsvktefnskdlatkyknkdvdifgsnyyyncyysegnscknakktcmyggvtehhrnq
    iegkfpnitvkvyednenilsfdittnkkqvtvqeldcktrkilvsrknlyefnnspyet
    gyikfiessgdsfwydmmpapgaifdqskylmlyndnktvsssaiaievhltkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxtA (A:)
    ssqpdptpeqlnkssqftgvmgnlrclydnhfvegtnvrstgqllqhdlifpikdlklkn
    ydsvktefnskdlatkyknkdvdifgsnyyyncktcmyggvtehhrnqiegkfpnitvkv
    yednenilsfdittnkkqvtvqeldcktrkilvsrknlyefnnspyetgyikfiessgds
    fwydmmpapgaifdqskylmlyndnktvsssaiaievhltkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bxtB (B:)
    ssqpdptpeqlnkssqftgvmgnlrclydnhfvegtnvrstgqllqhdlifpikdlklkn
    ydsvktefnskdlatkyknkdvdifgsnyyyncyysegnscknakktcmyggvtehhrnq
    iegkfpnitvkvyednenilsfdittnkkqvtvqeldcktrkilvsrknlyefnnspyet
    gyikfiessgdsfwydmmpapgaifdqskylmlyndnktvsssaiaievhltkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxtB (B:)
    ssqpdptpeqlnkssqftgvmgnlrclydnhfvegtnvrstgqllqhdlifpikdlklkn
    ydsvktefnskdlatkyknkdvdifgsnyyyncyyktcmyggvtehhrnqiegkfpnitv
    kvyednenilsfdittnkkqvtvqeldcktrkilvsrknlyefnnspyetgyikfiessg
    dsfwydmmpapgaifdqskylmlyndnktvsssaiaievhltkk