PDB entry 1bxq

View 1bxq on RCSB PDB site
Description: acid proteinase (penicillopepsin) complex with phosphonate inhibitor.
Class: hydrolase
Keywords: hydrolase, phosphonate inhibitors
Deposited on 1998-10-07, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (penicillopepsin)
    Species: Penicillium janthinellum [TaxId:5079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bxqa_
  • Heterogens: MAN, SO4, ACT, PP8, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxqA (A:)
    aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
    atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
    llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
    ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
    naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
    iflksqyvvfdsdgpqlgfapqa