PDB entry 1bxp

View 1bxp on RCSB PDB site
Description: solution nmr structure of the complex of alpha-bungarotoxin with a library derived peptide, 20 structures
Class: complex (toxin/peptide)
Keywords: complex (toxin/peptide), alpha-bungarotoxin, library peptide
Deposited on 1998-08-23, released 1999-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-bungarotoxin
    Species: Bungarus multicinctus [TaxId:8616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bxpa_
  • Chain 'B':
    Compound: peptide met-arg-tyr-tyr-glu-ser-ser-leu-lys-ser-tyr-pro-asp
    Database cross-references and differences (RAF-indexed):
    • PDB 1BXP (0-12)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxpA (A:)
    ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrpg
    

  • Chain 'B':
    No sequence available.