PDB entry 1bxo

View 1bxo on RCSB PDB site
Description: acid proteinase (penicillopepsin) (e.c.3.4.23.20) complex with phosphonate inhibitor: methyl cyclo[(2s)-2-[[(1r)-1-(n-(l-n-(3-methylbutanoyl)valyl-l-aspartyl)amino)-3-methylbut yl] hydroxyphosphinyloxy]-3-(3-aminomethyl) phenylpropanoate
Class: hydrolase
Keywords: hydrolase, phosphonate inhibitors, macrocycle
Deposited on 1998-10-07, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 0.9500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (penicillopepsin)
    Species: Penicillium janthinellum [TaxId:5079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bxoa_
  • Heterogens: MAN, SO4, PP7, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxoA (A:)
    aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
    atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
    llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
    ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
    naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
    iflksqyvvfdsdgpqlgfapqa