PDB entry 1bxm

View 1bxm on RCSB PDB site
Description: engineered beta-cryptogein complexed with ergosterol
Deposited on 1998-10-05, released 1999-06-15
The last revision prior to the SCOP 1.57 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.189
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1bxm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxm_ (-)
    rgtctatqqtaayhtlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntm
    ikkivtlnppncdltvptsglvlnvysyangfsnkcssl