PDB entry 1bxm

View 1bxm on RCSB PDB site
Description: engineered beta-cryptogein complexed with ergosterol
Class: fungal toxic elicitor
Keywords: fungal toxic elicitor mutant, elicitin, phytophthora, sterol, plant pathogen
Deposited on 1998-10-05, released 1999-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.189
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-cryptogein
    Species: Phytophthora cryptogea [TaxId:4786]
    Gene: CRY (MUTATED LYS 13 HIS)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15570 (3-98)
      • engineered (13)
    Domains in SCOPe 2.08: d1bxma_
  • Heterogens: ERG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bxmA (A:)
rgtctatqqtaayhtlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntm
ikkivtlnppncdltvptsglvlnvysyangfsnkcssl