PDB entry 1bxl

View 1bxl on RCSB PDB site
Description: structure of bcl-xl/bak peptide complex, nmr, minimized average structure
Class: complex (apoptosis/peptide)
Keywords: apoptosis, alternative splicing, complex (apoptosis/peptide)
Deposited on 1996-10-16, released 1997-10-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bcl-xl
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bxla1, d1bxla2, d1bxla3
  • Chain 'B':
    Compound: bak peptide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bxlA (A:)
    msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnps
    whladspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitp
    gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
    hlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxlA (A:)
    msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
    felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
    kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhh
    h
    

  • Chain 'B':
    No sequence available.