PDB entry 1bxl

View 1bxl on RCSB PDB site
Description: structure of bcl-xl/bak peptide complex, nmr, minimized average structure
Deposited on 1996-10-16, released 1997-10-29
The last revision prior to the SCOP 1.57 freeze date was dated 1997-10-29, with a file datestamp of 1997-10-29.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1bxla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bxlA (A:)
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhh
h