PDB entry 1bxh

View 1bxh on RCSB PDB site
Description: concanavalin a complexed to methyl alpha1-2 mannobioside
Class: sugar binding protein
Keywords: carbohydrate conformation, con a saccharide complex, molecular recognition, thermodynamics, sugar binding protein
Deposited on 1998-10-02, released 1998-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bxha_
  • Chain 'B':
    Compound: Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bxhb_
  • Chain 'C':
    Compound: Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bxhc_
  • Chain 'D':
    Compound: Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bxhd_
  • Heterogens: AMG, MMA, MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxhA (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxhB (B:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxhC (C:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxhD (D:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan