PDB entry 1bxg

View 1bxg on RCSB PDB site
Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and beta-phenylpropionate
Class: amino acid dehydrogenase
Keywords: amino acid dehydrogenase, oxidative deamination mechanism
Deposited on 1998-10-02, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanine dehydrogenase
    Species: Rhodococcus sp. [TaxId:1831]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59771
      • see remark 999 (19-20)
    Domains in SCOPe 2.08: d1bxga1, d1bxga2
  • Chain 'B':
    Compound: phenylalanine dehydrogenase
    Species: Rhodococcus sp. [TaxId:1831]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59771
      • see remark 999 (20)
    Domains in SCOPe 2.08: d1bxgb1, d1bxgb2
  • Heterogens: K, PO4, NAD, HCI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bxgA (A:)
    msidsalnwdgemtvtrfdsktgahfvirldstqlgpaaggtraaqysqladaltdagkl
    agamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdv
    ntnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvl
    vqglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapca
    mggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgre
    vlgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrareastttata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxgA (A:)
    sidsalnwdgemtvtrfdsktgahfvirldstqlgpaaggtraaqysqladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrareas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bxgB (B:)
    msidsalnwdgemtvtrfdrmtgahfvirldstqlgpaaggtraaqysqladaltdagkl
    agamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdv
    ntnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvl
    vqglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapca
    mggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgre
    vlgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrareastttata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bxgB (B:)
    sidsalnwdgemtvtrfdrmtgahfvirldstqlgpaaggtraaqysqladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrare