PDB entry 1bxe

View 1bxe on RCSB PDB site
Description: ribosomal protein l22 from thermus thermophilus
Class: RNA binding protein
Keywords: ribosomal protein, protein synthesis, RNA binding, antibiotics resistance
Deposited on 1998-10-02, released 1998-10-07
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribosomal protein l22)
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48286 (0-End)
      • mutation (0)
      • mutation (63)
    Domains in SCOP 1.75: d1bxea_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1bxeA (A:)
meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgekhgk

    Sequence, based on observed residues (ATOM records): (download) 
    >1bxeA (A:)
meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek