PDB entry 1bxe
View 1bxe on RCSB PDB site
Description: ribosomal protein l22 from thermus thermophilus
Class: RNA binding protein
Keywords: ribosomal protein, protein synthesis, RNA binding, antibiotics resistance, RNA binding protein
Deposited on
1998-10-02, released
1998-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-03-14, with a file datestamp of
2018-03-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (ribosomal protein l22)
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P48286 (0-End)
- engineered mutation (0)
- engineered mutation (63)
Domains in SCOPe 2.08: d1bxea_ - Heterogens: CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1bxeA (A:)
meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgekhgk
Sequence, based on observed residues (ATOM records): (download)
>1bxeA (A:)
meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek