PDB entry 1bxd

View 1bxd on RCSB PDB site
Description: nmr structure of the histidine kinase domain of the e. coli osmosensor envz
Class: transferase
Keywords: histidine kinase, osmosensor, his-asp phosphorelay system, signal transduction, transferase
Deposited on 1998-10-02, released 1999-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (osmolarity sensor protein (envz))
    Species: Escherichia coli BL21(DE3) [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bxda_
  • Heterogens: ANP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bxdA (A:)
tgqempmemadlnavlgeviaaesgyereietalypgsievkmhplsikravanmvvnaa
rygngwikvssgtepnrawfqveddgpgiapeqrkhlfqpfvrgdsartisgtglglaiv
qrivdnhngmlelgtsergglsirawlpvpvtraqgttkeg