PDB entry 1bxc

View 1bxc on RCSB PDB site
Description: xylose isomerase from thermus caldophilus
Class: isomerase
Keywords: isomerase, xylose metabolism
Deposited on 1998-10-02, released 1999-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.178
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Thermus caldophilus [TaxId:272]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56681 (0-386)
      • conflict (64)
    Domains in SCOPe 2.07: d1bxca_
  • Chain 'B':
    Compound: xylose isomerase
    Species: Thermus caldophilus [TaxId:272]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56681 (0-386)
      • conflict (64)
    Domains in SCOPe 2.07: d1bxcb_
  • Chain 'C':
    Compound: xylose isomerase
    Species: Thermus caldophilus [TaxId:272]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56681 (0-386)
      • conflict (64)
    Domains in SCOPe 2.07: d1bxcc_
  • Chain 'D':
    Compound: xylose isomerase
    Species: Thermus caldophilus [TaxId:272]
    Gene: XYLA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56681 (0-386)
      • conflict (64)
    Domains in SCOPe 2.07: d1bxcd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxcA (A:)
    myepkpehrftfglwtvgnvgrdpfgdavrerldpvyvghklaelgvhgvnlhdedlipr
    gtppqerdqivrrfkraldetglkvpmvtgnlfsdpgfkdggftsrdpwvrayafrksle
    tmdlgaelgaeiyvvwpgregaeveatgkarkvwdwvreplnfmaayaedqgygyrfale
    pkpneprgdiyfatvgsmlalihtlerperfglnpefahetmaglnfvhavaqaldagkl
    lhidlngqrmnrfdqdlrfgsenlkaafllvdllessgyqgprhfdahalrtedeegvwa
    fargcmrtylilkeraeafredpevkellaayyqedpaalplmdpyshekaealkraelp
    leakrhrgyalerldqlaveyllgvrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxcB (B:)
    myepkpehrftfglwtvgnvgrdpfgdavrerldpvyvghklaelgvhgvnlhdedlipr
    gtppqerdqivrrfkraldetglkvpmvtgnlfsdpgfkdggftsrdpwvrayafrksle
    tmdlgaelgaeiyvvwpgregaeveatgkarkvwdwvreplnfmaayaedqgygyrfale
    pkpneprgdiyfatvgsmlalihtlerperfglnpefahetmaglnfvhavaqaldagkl
    lhidlngqrmnrfdqdlrfgsenlkaafllvdllessgyqgprhfdahalrtedeegvwa
    fargcmrtylilkeraeafredpevkellaayyqedpaalplmdpyshekaealkraelp
    leakrhrgyalerldqlaveyllgvrg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxcC (C:)
    myepkpehrftfglwtvgnvgrdpfgdavrerldpvyvghklaelgvhgvnlhdedlipr
    gtppqerdqivrrfkraldetglkvpmvtgnlfsdpgfkdggftsrdpwvrayafrksle
    tmdlgaelgaeiyvvwpgregaeveatgkarkvwdwvreplnfmaayaedqgygyrfale
    pkpneprgdiyfatvgsmlalihtlerperfglnpefahetmaglnfvhavaqaldagkl
    lhidlngqrmnrfdqdlrfgsenlkaafllvdllessgyqgprhfdahalrtedeegvwa
    fargcmrtylilkeraeafredpevkellaayyqedpaalplmdpyshekaealkraelp
    leakrhrgyalerldqlaveyllgvrg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxcD (D:)
    myepkpehrftfglwtvgnvgrdpfgdavrerldpvyvghklaelgvhgvnlhdedlipr
    gtppqerdqivrrfkraldetglkvpmvtgnlfsdpgfkdggftsrdpwvrayafrksle
    tmdlgaelgaeiyvvwpgregaeveatgkarkvwdwvreplnfmaayaedqgygyrfale
    pkpneprgdiyfatvgsmlalihtlerperfglnpefahetmaglnfvhavaqaldagkl
    lhidlngqrmnrfdqdlrfgsenlkaafllvdllessgyqgprhfdahalrtedeegvwa
    fargcmrtylilkeraeafredpevkellaayyqedpaalplmdpyshekaealkraelp
    leakrhrgyalerldqlaveyllgvrg