PDB entry 1bxa

View 1bxa on RCSB PDB site
Description: amicyanin reduced, ph 4.4, 1.3 angstroms
Class: electron transport
Keywords: electron transport
Deposited on 1998-10-01, released 1998-10-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.169
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (amicyanin)
  Species: Paracoccus denitrificans [TaxId:266]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22364 (0-104)
  Domains in SCOPe 2.04: d1bxaa_
• Heterogens: CU1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bxaA (A:)
  dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
  vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve