PDB entry 1bxa

View 1bxa on RCSB PDB site
Description: amicyanin reduced, ph 4.4, 1.3 angstroms
Class: electron transport
Keywords: electron transport
Deposited on 1998-10-01, released 1998-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (amicyanin)
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bxaa_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bxaA (A:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve